PDB entry 1h3i

View 1h3i on RCSB PDB site
Description: crystal structure of the histone methyltransferase set7/9
Deposited on 2002-09-04, released 2002-11-11
The last revision prior to the SCOP 1.69 freeze date was dated 2002-11-11, with a file datestamp of 2002-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21221
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3iA (A:)
    fffdgstlegyyvddalqgqgvytyedggvlqgtyvdgelngpaqeydtdgrlifkgqyk
    dnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklat
    lmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglf
    skvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycasl
    ghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3iB (B:)
    fffdgstlegyyvddalqgqgvytyedggvlqgtyvdgelngpaqeydtdgrlifkgqyk
    dnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklat
    lmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglf
    skvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycasl
    ghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgk