PDB entry 1h3h

View 1h3h on RCSB PDB site
Description: structural basis for specific recognition of an rxxk-containing slp-76 peptide by the gads c-terminal sh3 domain
Class: complex (sh3/peptide)
Keywords: T-cell signaling, sh3 domain, sh2 domain
Deposited on 2002-09-03, released 2003-03-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-03-06, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GRB2-related adaptor protein 2
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1h3ha_
  • Chain 'B':
    Compound: lymphocyte cytosolic protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13094 (0-9)
    • PDB 1H3H (10-10)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3hA (A:)
    grvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr
    

  • Chain 'B':
    No sequence available.