PDB entry 1h3g

View 1h3g on RCSB PDB site
Description: cyclomaltodextrinase from flavobacterium sp. no. 92: from DNA sequence to protein structure
Class: hydrolase
Keywords: cyclomaltodextrinase, signal, hydrolase, glycosidase
Deposited on 2002-09-03, released 2003-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrinase
    Species: FLAVOBACTERIUM SP. [TaxId:239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h3ga1, d1h3ga2, d1h3ga3
  • Chain 'B':
    Compound: cyclomaltodextrinase
    Species: FLAVOBACTERIUM SP. [TaxId:239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h3gb1, d1h3gb2, d1h3gb3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3gA (A:)
    maptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfv
    dleigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfang
    dpsndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysy
    hgyaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwi
    nyggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwi
    eyaglsglridtygysdgaflteytrrlmaeyprlnmvgeewstrvpvvarwqrgkanfd
    gytshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdma
    rmfsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagd
    kanafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkri
    mvamnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3gA (A:)
    ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfvdl
    eigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfangdp
    sndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysyhg
    yaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwiny
    ggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwiey
    aglsglridtygysdgaflteytrrlmaeyprlnmvgeewstrvpvvarwqrgkanfdgy
    tshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdmarm
    fsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagdka
    nafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkrimv
    amnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h3gB (B:)
    maptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfv
    dleigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfang
    dpsndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysy
    hgyaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwi
    nyggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwi
    eyaglsglridtygysdgaflteytrrlmaeyprlnmvgeewstrvpvvarwqrgkanfd
    gytshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdma
    rmfsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagd
    kanafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkri
    mvamnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3gB (B:)
    ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfvdl
    eigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfangdp
    sndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysyhg
    yaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwiny
    ggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwiey
    aglsglridtygysdgaflteytrrlmaeyprlnmvgeewstrvpvvarwqrgkanfdgy
    tshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdmarm
    fsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagdka
    nafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkrimv
    amnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe