PDB entry 1h34

View 1h34 on RCSB PDB site
Description: crystal structure of lima bean trypsin inhibitor
Class: inhibitor
Keywords: inhibitor, bowman-birk-type proteinase inhibitor, serine protease inhibitor
Deposited on 2002-08-21, released 2003-02-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.2529
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bowman-birk type proteinase inhibitor
    Species: PHASEOLUS LUNATUS [TaxId:3884]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01056
      • conflict (22)
    Domains in SCOPe 2.02: d1h34a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h34A (A:)
    sghhehstdzpszsskpccdhcsctksippqcrctdlrldschsackscictlsipaqcv
    cddiddfcyepcksshsdddnnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h34A (A:)
    kpccdhcsctksippqcrctdlrldschsackscictlsipaqcvcddiddfcyepc