PDB entry 1h2p

View 1h2p on RCSB PDB site
Description: human cd55 domains 3 & 4
Class: immune system protein
Keywords: immune system protein, complement decay accelerating factor, enteroviral receptor, bacterial receptor, ligand for cd97, complement pathway, alternative splicing, gpi-anchor
Deposited on 2002-08-13, released 2003-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.258
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'P':
  Compound: complement decay-accelerating factor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08174 (0-124)
    • conflict (7)
  Domains in SCOPe 2.07: d1h2pp1, d1h2pp2

PDB Chain Sequences:

• Chain 'P':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h2pP (P:)
  kscpnpgqirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
  reiycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpp
  pecrg