PDB entry 1h2p

View 1h2p on RCSB PDB site
Description: human cd55 domains 3 & 4
Class: immune system protein
Keywords: complement decay accelerating factor, enteroviral receptor, bacterial receptor, ligand for cd97, complement pathway, alternative splicing, gpi-anchor
Deposited on 2002-08-13, released 2003-03-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.258
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: complement decay-accelerating factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08174 (0-124)
      • conflict (7)
    Domains in SCOP 1.73: d1h2pp1, d1h2pp2

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h2pP (P:)
    kscpnpgqirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
    reiycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpp
    pecrg