PDB entry 1h2o

View 1h2o on RCSB PDB site
Description: solution structure of the major cherry allergen pru av 1 mutant e45w
Deposited on 2002-08-12, released 2003-08-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-05, with a file datestamp of 2004-01-05.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h2oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h2oA (A:)
gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilwgdggpgtikkitfge
gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy
htkgnveikeehvkagkekasnlfklietylkghpdayn