PDB entry 1h2o

View 1h2o on RCSB PDB site
Description: solution structure of the major cherry allergen pru av 1 mutant e45w
Class: allergen
Keywords: allergen, major cherry allergen, pathogenesis-related protein, heteronuclear nmr, structure, plant defense
Deposited on 2002-08-12, released 2003-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major allergen pru av 1
    Species: Prunus avium [TaxId:42229]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24248 (0-158)
      • engineered mutation (44)
    Domains in SCOPe 2.08: d1h2oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h2oA (A:)
    gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilwgdggpgtikkitfge
    gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy
    htkgnveikeehvkagkekasnlfklietylkghpdayn