PDB entry 1h2l

View 1h2l on RCSB PDB site
Description: factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Class: transcription activator/inhibitor
Keywords: fih, hif, dsbh, oxygenase, transcription, hypoxia, 2-oxoglutarate, asparaginyl hydroxylase, hydroxylase
Deposited on 2002-08-12, released 2002-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.18514
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor inhibiting hif1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1h2la_
  • Chain 'S':
    Compound: Hypoxia-inducible factor 1 alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1h2ls_
  • Heterogens: FE2, SO4, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h2lA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2lA (A:)
    epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
    kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
    iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
    vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
    fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpeyplkahqkva
    imrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1h2lS (S:)
    smdesglpqltsydcevnapiqgsrnllqgeellraldqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2lS (S:)
    ltsydcevnapilqgeellral