PDB entry 1h2l

View 1h2l on RCSB PDB site
Description: factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Deposited on 2002-08-12, released 2002-11-28
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-30, with a file datestamp of 2003-01-30.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.18514
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1h2la_
  • Chain 'S':
    Domains in SCOP 1.63: d1h2ls_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h2lA (A:)
    epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
    kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
    iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
    vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
    fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkahq
    kvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2lA (A:)
    epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
    kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
    iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
    vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
    fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpeyplkahqkva
    imrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1h2lS (S:)
    ltsydcevnapiqgsrnllqgeellral
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2lS (S:)
    ltsydcevnapilqgeellral