PDB entry 1h2k

View 1h2k on RCSB PDB site
Description: factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Deposited on 2002-08-12, released 2002-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-30, with a file datestamp of 2003-01-30.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.18026
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h2ka_
  • Chain 'S':
    Domains in SCOP 1.71: d1h2ks_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h2kA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2kA (A:)
    epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
    kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
    iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
    vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
    fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpeyplkahqkva
    imrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1h2kS (S:)
    smdesglpqltsydcevnapiqgsrnllqgeellraldqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2kS (S:)
    ltsydcevnapillqgeellrald