PDB entry 1h2k

View 1h2k on RCSB PDB site
Description: factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Class: transcription activator/inhibitor
Keywords: transcription activator-inhibitor complex, fih, hif, dsbh, oxygenase, transcription, hypoxia, 2- oxoglutarate, asparaginyl hydroxylase, phosphorylation
Deposited on 2002-08-12, released 2002-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor inhibiting hif1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h2ka_
  • Chain 'S':
    Compound: Hypoxia-inducible factor 1 alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h2ks_
  • Heterogens: FE2, OGA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h2kA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2kA (A:)
    epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
    kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
    iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
    vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
    fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpeyplkahqkva
    imrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1h2kS (S:)
    smdesglpqltsydcevnapiqgsrnllqgeellraldqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2kS (S:)
    ltsydcevnapillqgeellrald