PDB entry 1h2j

View 1h2j on RCSB PDB site
Description: endoglucanase cel5a in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-cellobioside at 1.15 a resolution
Class: hydrolase
Keywords: hydrolase, glycosidase, endoglucanase
Deposited on 2002-08-09, released 2002-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.118
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase 5a
    Species: Bacillus agaradhaerens [TaxId:76935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h2ja_
  • Heterogens: DCB, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h2jA (A:)
    dndsvveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginv
    fraamytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffd
    emselygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsq
    dvhhaadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggv
    fldeaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvreki
    res
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2jA (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires