PDB entry 1h2h

View 1h2h on RCSB PDB site
Description: Crystal structure of TM1643
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function, possible nad-dependent oxidoreductase, psi, protein structure initiative, nesg, northeast structural genomics consortium
Deposited on 2002-08-08, released 2002-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein tm1643
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h2ha3, d1h2ha4
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h2hA (A:)
    mtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecaspea
    vkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsgaiggldvlssik
    dfvknvrietikppkslgldlkgktvvfegsveeasklfprninvastiglivgfekvkv
    tivadpamdhnihivrissaignyefkienipspenpktsmltvysilrtlrnleskiif
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2hA (A:)
    mtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecaspea
    vkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsgaiggldvlssik
    dfvknvrietikppkslgldlkgktvvfegsveeasklfprninvastiglivgfekvkv
    tivadpamdhnihivrissaignyefkienismltvysilrtlrnleskiifg