PDB entry 1h2f

View 1h2f on RCSB PDB site
Description: bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate
Deposited on 2002-08-08, released 2002-08-12
The last revision prior to the SCOP 1.63 freeze date was dated 2002-08-12, with a file datestamp of 2002-08-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1h2fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h2fA (A:)
attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
tiievdggtfhvavegdvshieevkev