PDB entry 1h2f

View 1h2f on RCSB PDB site
Description: bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate
Class: hydrolase
Keywords: hydrolase, broad specificity phosphatase; dpgm homolog
Deposited on 2002-08-08, released 2002-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H2F (201-206)
    • Uniprot Q9ALU0 (6-200)
    Domains in SCOPe 2.08: d1h2fa_
  • Heterogens: VA3, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h2fA (A:)
    attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
    etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
    rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
    tiievdggtfhvavegdvshieevkev