PDB entry 1h2e

View 1h2e on RCSB PDB site
Description: bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate
Deposited on 2002-08-08, released 2002-08-12
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-12, with a file datestamp of 2002-08-12.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.213
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1h2ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h2eA (A:)
attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
tiievdggtfhvavegdvshieevkev