PDB entry 1h2b

View 1h2b on RCSB PDB site
Description: crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution
Class: oxidoreductase
Keywords: oxidoreductase, archaea, hyperthermophile, alcohol dehydrogenase oxidoreductase, zinc
Deposited on 2002-08-02, released 2003-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.16829
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h2ba1, d1h2ba2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h2bb1, d1h2bb2
  • Heterogens: OCA, NAJ, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h2bA (A:)
    mrieqdfsqslgverlkaarlheynkplriedvdyprlegrfdvivriagagvchtdlhl
    vqgmwhellqpklpytlghenvgyieevaegveglekgdpvilhpavtdgtclacraged
    mhcenlefpglnidggfaefmrtshrsviklpkdisreklvemapladagitayravkka
    artlypgayvaivgvgglghiavqllkvmtpatvialdvkeeklklaerlgadhvvdarr
    dpvkqvmeltrgrgvnvamdfvgsqatvdytpyllgrmgrliivgyggelrfptirviss
    evsfegslvgnyvelhelvtlalqgkvrvevdihkldeindvlerlekgevlgravlip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2bA (A:)
    kaarlheynkplriedvdyprlegrfdvivriagagvchtdlhlvqgmwhellqpklpyt
    lghenvgyieevaegveglekgdpvilhpavtdgtclacragedmhcenlefpglnidgg
    faefmrtshrsviklpkdisreklvemapladagitayravkkaartlypgayvaivgvg
    glghiavqllkvmtpatvialdvkeeklklaerlgadhvvdarrdpvkqvmeltrgrgvn
    vamdfvgsqatvdytpyllgrmgrliivgyggelrfptirvissevsfegslvgnyvelh
    elvtlalqgkvrvevdihkldeindvlerlekgevlgravlip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h2bB (B:)
    mrieqdfsqslgverlkaarlheynkplriedvdyprlegrfdvivriagagvchtdlhl
    vqgmwhellqpklpytlghenvgyieevaegveglekgdpvilhpavtdgtclacraged
    mhcenlefpglnidggfaefmrtshrsviklpkdisreklvemapladagitayravkka
    artlypgayvaivgvgglghiavqllkvmtpatvialdvkeeklklaerlgadhvvdarr
    dpvkqvmeltrgrgvnvamdfvgsqatvdytpyllgrmgrliivgyggelrfptirviss
    evsfegslvgnyvelhelvtlalqgkvrvevdihkldeindvlerlekgevlgravlip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h2bB (B:)
    lkaarlheynkplriedvdyprlegrfdvivriagagvchtdlhlvqgmwhellqpklpy
    tlghenvgyieevaegveglekgdpvilhpavtdgtclacragedmhcenlefpglnidg
    gfaefmrtshrsviklpkdisreklvemapladagitayravkkaartlypgayvaivgv
    gglghiavqllkvmtpatvialdvkeeklklaerlgadhvvdarrdpvkqvmeltrgrgv
    nvamdfvgsqatvdytpyllgrmgrliivgyggelrfptirvissevsfegslvgnyvel
    helvtlalqgkvrvevdihkldeindvlerlekgevlgravlip