PDB entry 1h26

View 1h26 on RCSB PDB site
Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p53
Class: cell cycle
Keywords: cell cycle, protein kinase, cyclin, cdk2, recruitment, peptide specificity
Deposited on 2002-07-31, released 2003-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H26 (Start-4)
    • Uniprot P24941 (5-End)
    Domains in SCOPe 2.06: d1h26a1, d1h26a2
  • Chain 'B':
    Compound: cyclin a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h26b1, d1h26b2
  • Chain 'C':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H26 (Start-4)
    • Uniprot P24941 (5-End)
    Domains in SCOPe 2.06: d1h26c1, d1h26c2
  • Chain 'D':
    Compound: cyclin a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h26d1, d1h26d2
  • Chain 'E':
    Compound: Cellular tumor antigen p53
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h26A (A:)
    gplgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisll
    kelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgl
    afchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeill
    gckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpd
    ykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    lrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h26A (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h26B (B:)
    evpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlh
    lavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlr
    mehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylps
    viagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsireky
    knskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h26B (B:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h26C (C:)
    gplgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisll
    kelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgl
    afchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeill
    gckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpd
    ykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    lrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h26C (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtvvppldedgrsllsqmlh
    ydpnkrisakaalahpffqdvtkpvphlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h26D (D:)
    evpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlh
    lavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlr
    mehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylps
    viagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsireky
    knskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h26D (D:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

  • Chain 'E':
    No sequence available.