PDB entry 1h21

View 1h21 on RCSB PDB site
Description: a novel iron centre in the split-soret cytochrome c from desulfovibrio desulfuricans atcc 27774
Class: cytochrome
Keywords: cytochrome, dimeric di-heme cytochrome, stacked heme arrangement, novel fold, novel iron-sulfur centre, electron transport, sulfate respiration
Deposited on 2002-07-30, released 2003-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: split-soret cytochrome c
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81040 (Start-246)
      • conflict see remark 9 (85)
      • conflict see remark 9 (170)
    Domains in SCOPe 2.07: d1h21a_
  • Chain 'B':
    Compound: split-soret cytochrome c
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81040 (Start-246)
      • conflict see remark 9 (85)
      • conflict see remark 9 (170)
    Domains in SCOPe 2.07: d1h21b_
  • Chain 'C':
    Compound: split-soret cytochrome c
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81040 (Start-246)
      • conflict see remark 9 (85)
      • conflict see remark 9 (170)
    Domains in SCOPe 2.07: d1h21c_
  • Chain 'D':
    Compound: split-soret cytochrome c
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81040 (Start-246)
      • conflict see remark 9 (85)
      • conflict see remark 9 (170)
    Domains in SCOPe 2.07: d1h21d_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h21A (A:)
    geaqpasgrfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgeky
    gapynqfpfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtk
    lpifnpgdaaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaaf
    kaaeiintkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatq
    nkfvnhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h21A (A:)
    grfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqf
    pfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpg
    daaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaafkaaeiin
    tkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnhp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h21B (B:)
    geaqpasgrfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgeky
    gapynqfpfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtk
    lpifnpgdaaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaaf
    kaaeiintkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatq
    nkfvnhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h21B (B:)
    grfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqf
    pfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpg
    daaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaafkaaeiin
    tkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnhp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h21C (C:)
    geaqpasgrfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgeky
    gapynqfpfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtk
    lpifnpgdaaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaaf
    kaaeiintkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatq
    nkfvnhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h21C (C:)
    grfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqf
    pfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpg
    daaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaafkaaeiin
    tkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnhp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h21D (D:)
    geaqpasgrfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgeky
    gapynqfpfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtk
    lpifnpgdaaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaaf
    kaaeiintkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatq
    nkfvnhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h21D (D:)
    grfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqf
    pfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpg
    daaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaafkaaeiin
    tkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnhp