PDB entry 1h1z

View 1h1z on RCSB PDB site
Description: the structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate and zinc
Deposited on 2002-07-25, released 2003-01-30
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-30, with a file datestamp of 2003-01-30.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.202
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h1za_
  • Chain 'B':
    Domains in SCOP 1.71: d1h1zb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h1zA (A:)
    maaaaaakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslr
    khtkayldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvsl
    rpgtpveevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdg
    glgpstidvaasagancivagssifgaaepgevisalrksvegsqnks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1zA (A:)
    aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka
    yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp
    veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps
    tidvaasagancivagssifgaaepgevisalrksvegsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h1zB (B:)
    maaaaaakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslr
    khtkayldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvsl
    rpgtpveevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdg
    glgpstidvaasagancivagssifgaaepgevisalrksvegsqnks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1zB (B:)
    aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka
    yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp
    veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps
    tidvaasagancivagssifgaaepgevisalrksvegsq