PDB entry 1h1y

View 1h1y on RCSB PDB site
Description: the structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate
Class: isomerase
Keywords: 3-epimerase, oxidative pentose phosphate pathway, isomerase
Deposited on 2002-07-25, released 2003-01-30
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.175
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-ribulose-5-phosphate 3-epimerase
    Species: Oryza sativa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1h1ya_
  • Chain 'B':
    Compound: d-ribulose-5-phosphate 3-epimerase
    Species: Oryza sativa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1h1yb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h1yA (A:)
    maaaaaakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslr
    khtkayldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvsl
    rpgtpveevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdg
    glgpstidvaasagancivagssifgaaepgevisalrksvegsqnks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1yA (A:)
    aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka
    yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp
    veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps
    tidvaasagancivagssifgaaepgevisalrksvegsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h1yB (B:)
    maaaaaakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslr
    khtkayldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvsl
    rpgtpveevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdg
    glgpstidvaasagancivagssifgaaepgevisalrksvegsqnks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1yB (B:)
    aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka
    yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp
    veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps
    tidvaasagancivagssifgaaepgevisalrksvegsq