PDB entry 1h1w

View 1h1w on RCSB PDB site
Description: high resolution crystal structure of the human pdk1 catalytic domain
Deposited on 2002-07-23, released 2003-07-17
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-17, with a file datestamp of 2003-07-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h1wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h1wA (A:)
    ppqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtre
    rdvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeiv
    saleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvs
    pellteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkar
    dlvekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1wA (A:)
    ppqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtre
    rdvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeiv
    saleylhgkgiihrdlkpenillnedmhiqitdfgtakvlsparansfvgtaqyvspell
    teksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlve
    kllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt