PDB entry 1h1t

View 1h1t on RCSB PDB site
Description: PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE IN COMPLEX WITH Coenzyme A FROM ESCHERICHIA COLI
Class: transferase
Keywords: transferase, coenzyme a biosynthesis, nucleotidyltransferase
Deposited on 2002-07-21, released 2003-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h1ta_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h1tb_
  • Heterogens: COA, SO4, PNS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h1tA (A:)
    mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
    hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
    skewsfissslvkevarhqgdvthflpenvhqalmakla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1tA (A:)
    qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
    lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
    kewsfissslvkevarhqgdvthflpenvhqalmakla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h1tB (B:)
    mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
    hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
    skewsfissslvkevarhqgdvthflpenvhqalmakla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1tB (B:)
    kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
    gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
    ewsfissslvkevarhqgdvthflpenvhqalmakla