PDB entry 1h1l

View 1h1l on RCSB PDB site
Description: nitrogenase mo-fe protein from klebsiella pneumoniae, nifv mutant
Deposited on 2002-07-18, released 2002-07-29
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-29, with a file datestamp of 2002-07-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1h1la_
  • Chain 'B':
    Domains in SCOP 1.61: d1h1lb_
  • Chain 'C':
    Domains in SCOP 1.61: d1h1lc_
  • Chain 'D':
    Domains in SCOP 1.61: d1h1ld_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h1lA (A:)
    tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
    cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
    divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
    rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
    eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
    tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
    vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
    sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h1lB (B:)
    sqtidkinscyplfeqdeyqelfrnkrqleeahdaqrvqevfawtttaeyealnfrreal
    tvdpakacqplgavlcslgfantlpyvhgsqgcvayfrtyfnrhfkepiacvsdsmteda
    avfggnnnmnlglqnasalykpeiiavsttcmaevigddlqafianakkdgfvdssiavp
    hahtpsfigshvtgwdnmfegfaktftadyqgqpgklpklnlvtgfetylgnfrvlkrmm
    eqmavpcsllsdpsevldtpadghyrmysggttqqemkeapdaidtlllqpwqllkskkv
    vqemwnqpatevaiplglaatdellmtvsqlsgkpiadaltlergrlvdmmldshtwlhg
    kkfglygdpdfvmgltrfllelgceptvilshnankrwqkamnkmldaspygrdsevfin
    cdlwhfrslmftrqpdfmignsygkfiqrdtlakgkafevplirlgfplfdrhhlhrqtt
    wgyegamnivttlvnavlekldsdtsqlgktdysfdlvr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h1lC (C:)
    tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
    cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
    divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
    rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
    eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
    tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
    vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
    sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h1lD (D:)
    sqtidkinscyplfeqdeyqelfrnkrqleeahdaqrvqevfawtttaeyealnfrreal
    tvdpakacqplgavlcslgfantlpyvhgsqgcvayfrtyfnrhfkepiacvsdsmteda
    avfggnnnmnlglqnasalykpeiiavsttcmaevigddlqafianakkdgfvdssiavp
    hahtpsfigshvtgwdnmfegfaktftadyqgqpgklpklnlvtgfetylgnfrvlkrmm
    eqmavpcsllsdpsevldtpadghyrmysggttqqemkeapdaidtlllqpwqllkskkv
    vqemwnqpatevaiplglaatdellmtvsqlsgkpiadaltlergrlvdmmldshtwlhg
    kkfglygdpdfvmgltrfllelgceptvilshnankrwqkamnkmldaspygrdsevfin
    cdlwhfrslmftrqpdfmignsygkfiqrdtlakgkafevplirlgfplfdrhhlhrqtt
    wgyegamnivttlvnavlekldsdtsqlgktdysfdlvr