PDB entry 1h1j

View 1h1j on RCSB PDB site
Description: the sap domain is a DNA-binding domain capable of binding s/mar DNA
Class: DNA binding
Keywords: sap domain, DNA binding
Deposited on 2002-07-16, released 2002-08-08
The last revision prior to the SCOP 1.73 freeze date was dated 2002-08-08, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Compound: tho1 protein
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1h1js_

PDB Chain Sequences:

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1h1jS (S:)
    gsadyssltvvqlkdlltkrnlsvgglknelvqrlikddeeskgesevspq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1jS (S:)
    gsadyssltvvqlkdlltkrnlsvgglknelvqrlikddeeskg