PDB entry 1h1h

View 1h1h on RCSB PDB site
Description: crystal structure of eosinophil cationic protein in complex with 2',5'-ADP at 2.0 a resolution reveals the details of the ribonucleolytic active site
Class: hydrolase
Keywords: hydrolase, eosinophil cationic protein, eosinophil derived neurotoxin, adenosine-2', 5'-diphosphate, ribonuclease, toxin
Deposited on 2002-07-15, released 2002-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eosinophil cationic protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H1H (0-0)
    • Uniprot P12724 (1-133)
    Domains in SCOPe 2.06: d1h1ha1, d1h1ha2
  • Heterogens: A2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h1hA (A:)
    mrppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqs
    ircphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprds
    prypvvpvhldtti