PDB entry 1h1c

View 1h1c on RCSB PDB site
Description: histidinol-phosphate aminotransferase (hisc) from thermotoga maritima
Deposited on 2002-07-08, released 2004-03-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-19, with a file datestamp of 2004-03-19.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.258
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h1ca_
  • Chain 'B':
    Domains in SCOP 1.71: d1h1cb_
  • Chain 'C':
    Domains in SCOP 1.71: d1h1cc_
  • Chain 'D':
    Domains in SCOP 1.71: d1h1cd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h1cA (A:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1cA (A:)
    liakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeelieki
    lsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpl
    tkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyv
    dflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakval
    dhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknv
    avrsfregvritigkreendmilrelevfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h1cB (B:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1cB (B:)
    ktylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekilsyldtdflsknnvs
    vgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpltkdlripevnvgegd
    vvfipnpnnptghvfereeierilktgafvaldeayyefhgesyvdflkkyenlavirtf
    skafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvaldhreifeertkfive
    erermksalremgyritdsrgnfvfvfmekeekerllehlrtknvavrsfregvritigk
    reendmilrelevfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h1cC (C:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1cC (C:)
    ylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekilsyldtdflsknnvsvg
    ngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpltkdlripevnvgegdvv
    fipnpnnptghvfereeierilktgafvaldeayyefhgesyvdflkkyenlavirtfsk
    afslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvaldhreifeertkfiveer
    ermksalremgyritdsrgnfvfvfmekeekerllehlrtknvavrsfregvritigkre
    endmilrele
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h1cD (D:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1cD (D:)
    iakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekil
    syldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevplt
    kdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyvd
    flkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvald
    hreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknva
    vrsfregvritigkreendmilrelevfk