PDB entry 1h15

View 1h15 on RCSB PDB site
Description:
Deposited on 2002-07-02, released 2002-10-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-10-03, with a file datestamp of 2002-10-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.256
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1h15a1, d1h15a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1h15b1, d1h15b2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1h15d1, d1h15d2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1h15e1, d1h15e2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h15A (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h15B (B:)
    dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
    nsqkdfledrraavdtycrhnygvgesftvqrrvepkvtvypartqtlqhhnllvcsvng
    fypgsievrwfrnsqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvt
    spltvewra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h15D (D:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h15E (E:)
    dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
    nsqkdfledrraavdtycrhnygvgesftvqrrvepkvtvypartqtlqhhnllvcsvng
    fypgsievrwfrnsqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvt
    spltvewra