PDB entry 1h13

View 1h13 on RCSB PDB site
Description: structure of a cold-adapted family 8 xylanase
Class: hydrolase
Keywords: hydrolase, xylan degradation, psychrophilic, cold adaptation, temperature, glycosyl hydrolase, family 8
Deposited on 2002-07-02, released 2003-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.12
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h13a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h13A (A:)
    afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
    ahyikainpdegddirtegqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
    vyawklklnqngfvykvdegpapdgeeyfafallnasarwgnsgefnyyndaitmlntik
    nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
    tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
    whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
    aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h13A (A:)
    afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
    ahyikainpdegddirtegqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
    vyawklklnqngfvykvdegpapdgeeyfafallnasarwgnsgefnyyndaitmlntik
    nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
    tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
    whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
    aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntf