PDB entry 1h11

View 1h11 on RCSB PDB site
Description:
Deposited on 2002-07-01, released 2002-08-08
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-08, with a file datestamp of 2002-08-08.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.10904
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1h11a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h11A (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires