PDB entry 1h10

View 1h10 on RCSB PDB site
Description: high resolution structure of the pleckstrin homology domain of protein kinase b/akt bound to ins(1,3,4,5)-tetrakisphophate
Class: transferase
Keywords: transferase, signalling protein, phosphoinositides, protein kinase b, pleckstrin, inositol tetrakisphophate, phosphorylation, serine/threonine protein kinase
Deposited on 2002-07-01, released 2003-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-alpha serine/threonine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H10 (Start-0)
    • Uniprot P31749 (1-End)
    Domains in SCOPe 2.08: d1h10a_
  • Heterogens: 4IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h10A (A:)
    smsdvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
    cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeeemd
    frsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h10A (A:)
    smsdvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
    cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeee