PDB entry 1h0z

View 1h0z on RCSB PDB site
Description: LEKTI domain six
Class: serine proteinase inhibitor
Keywords: serine proteinase inhibitor
Deposited on 2002-07-01, released 2003-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: serine protease inhibitor kazal-type 5, contains hemofiltrate peptide hf6478, hemofiltrate peptide hf7665
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NQ38 (0-67)
    • conflict (64)
  Domains in SCOPe 2.08: d1h0za_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h0zA (A:)
  esgkatsyaelcneyrklvrngklactrendpiqgpdgkvhgntcsmcevffqaeeeekk
  kkegesrn