PDB entry 1h0y

View 1h0y on RCSB PDB site
Description: structure of alba: an archaeal chromatin protein modulated by acetylation
Class: DNA binding
Keywords: archaea, chromatin, alba, acetylation, DNA binding
Deposited on 2002-07-01, released 2002-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.251
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA binding protein sso10b
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1h0ya_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1h0yA (A:)
mekmssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivr
nrflpdkieikeirvgsqvvtsqdgrqsrvstieiairkk

    Sequence, based on observed residues (ATOM records): (download) 
    >1h0yA (A:)
snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
eirvgsqvvtsqdgrqsrvstieiairkk