PDB entry 1h0x

View 1h0x on RCSB PDB site
Description: structure of alba: an archaeal chromatin protein modulated by acetylation
Class: DNA binding
Keywords: archaea, chromatin, alba, acetylation, DNA binding
Deposited on 2002-07-01, released 2002-09-05
The last revision prior to the SCOP 1.73 freeze date was dated 2002-09-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.235
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA binding protein sso10b
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1h0xa_
  • Chain 'B':
    Compound: DNA binding protein sso10b
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1h0xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h0xA (A:)
    mekmssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivr
    nrflpdkieikeirvgsqvvtsqdgrqsrvstieiairkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h0xA (A:)
    snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
    eirvgsqvvtsqdgrqsrvstieiairkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h0xB (B:)
    mekmssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivr
    nrflpdkieikeirvgsqvvtsqdgrqsrvstieiairkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h0xB (B:)
    snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
    eirvgsqvvtsqdgrqsrvstieiairkk