PDB entry 1h0l

View 1h0l on RCSB PDB site
Description: human prion protein 121-230 m166c/e221c
Class: cell cycle
Keywords: cell cycle, brain, glycoprotein, gpi-anchor, disease mutation
Deposited on 2002-06-24, released 2003-01-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H0L (0-1)
      • engineered mutation (47)
      • engineered mutation (102)
    • Uniprot P04156 (2-111)
    Domains in SCOPe 2.05: d1h0la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0lA (A:)
    gsvvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpcdeysnqnnfvhd
    cvnitikqhtvttttkgenftetdvkmmervveqmcitqyercsqayyqrgs