PDB entry 1h0l

View 1h0l on RCSB PDB site
Description: human prion protein 121-230 m166c/e221c
Deposited on 2002-06-24, released 2003-01-30
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-30, with a file datestamp of 2003-01-30.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h0la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h0lA (A:)
gsvvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpcdeysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcitqyercsqayyqrgs