PDB entry 1h0j

View 1h0j on RCSB PDB site
Description: structural basis of the membrane-induced cardiotoxin a3 oligomerization
Class: cardiotoxin
Keywords: cardiotoxin, sodium dodecyl sulfate, venom, cytotoxin
Deposited on 2002-06-20, released 2003-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cardiotoxin-3
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1h0ja_
  • Chain 'B':
    Compound: cardiotoxin-3
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1h0jb_
  • Chain 'C':
    Compound: cardiotoxin-3
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1h0jc_
  • Heterogens: SDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0jA (A:)
    lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0jB (B:)
    lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0jC (C:)
    lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn