PDB entry 1h0h

View 1h0h on RCSB PDB site
Description: Tungsten containing Formate Dehydrogenase from Desulfovibrio Gigas
Class: electron transport
Keywords: electron transport, tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, mgd, iron-sulphur cluster, periplasmic
Deposited on 2002-06-19, released 2003-02-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formate dehydrogenase subunit alpha
    Species: DESULFOVIBRIO GIGAS [TaxId:879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q934F5 (0-976)
      • conflict (958)
    Domains in SCOPe 2.04: d1h0ha1, d1h0ha2
  • Chain 'B':
    Compound: formate dehydrogenase subunit beta
    Species: DESULFOVIBRIO GIGAS [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1h0hb_
  • Chain 'K':
    Compound: formate dehydrogenase subunit alpha
    Species: DESULFOVIBRIO GIGAS [TaxId:879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q934F5 (0-976)
      • conflict (958)
    Domains in SCOPe 2.04: d1h0hk1, d1h0hk2
  • Chain 'L':
    Compound: formate dehydrogenase subunit beta
    Species: DESULFOVIBRIO GIGAS [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1h0hl_
  • Heterogens: W, 2MD, MGD, UNX, SF4, CA, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0hA (A:)
    atmalktvdakqttsvccycsvgcglivhtdkktnrainvegdpdhpinegslcakgast
    wqlaenerrpanplyrapgsdqweekswdwmldtiaervaktreatfvtknakgqvvnrc
    dgiasvgsaamdneecwiyqawlrslglfyiehqariahsatvaalaesygrgamtnhwi
    dlknsdvilmmgsnpaenhpisfkwvmrakdkgatlihvdprytrtstkcdlyaplrsgs
    diaflngmtkyilekelyfkdyvvnytnasfivgegfafeeglfagynketrkydkskwg
    ferdengnpkrdetlkhprcvfqimkkhyerydldkisaicgtpkelilkvydaycatgk
    pdkagtimyamgwtqhtvgvqniramsinqlllgnigvagggvnalrgeanvqgstdhgl
    lmhiypgylgtarasiptyeeytkkftpvskdpqsanwwsnfpkysasyiksmwpdadln
    eaygylpkgedgkdyswltlfddmfqgkikgffawgqnpacsgansnktrealtkldwmv
    nvnifdnetgsfwrgpdmdpkkiktevfflpcavaiekegsisnsgrwmqwryvgpeprk
    naipdgdlivelakrvqkllaktpgklaapvtklktdywvndhghfdphkiaklingfal
    kdfkvgdveykagqqiatfghlqadgsttsgcwiytgsytekgnmaarrdktqtdmqaki
    glypgwtwawpvnrriiynrasvdlngkpyapekavvewnaaekkwvgdvpdgpwppqad
    kekgkrafimkpegyaylygpgredgplpeyyepmecpviehpfsktlhnptalhfatee
    kavcdprypficstyrvtehwqtglmtrntpwlleaepqmfcemseelatlrgikngdkv
    ilesvrgklwakaiitkrikpfaiqgqqvhmvgipwhygwsfpknggdaaniltpsvgnp
    ntgipetkafmvnvtka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0hB (B:)
    skgffvdttrctacrgcqvackqwhgnpatptentgfhqnppdfnfhtyklvrmheqeid
    gridwlffpdqcrhciappckatadmedesaiihddatgcvlftpktkdledyesvisac
    pydvprkvaesnqmakcdmcidritnglrpacvtscptgamnfgdlsemeamasarlaei
    kaaysdaklcdpddvrvifltahnpklyheyava
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0hK (K:)
    atmalktvdakqttsvccycsvgcglivhtdkktnrainvegdpdhpinegslcakgast
    wqlaenerrpanplyrapgsdqweekswdwmldtiaervaktreatfvtknakgqvvnrc
    dgiasvgsaamdneecwiyqawlrslglfyiehqariahsatvaalaesygrgamtnhwi
    dlknsdvilmmgsnpaenhpisfkwvmrakdkgatlihvdprytrtstkcdlyaplrsgs
    diaflngmtkyilekelyfkdyvvnytnasfivgegfafeeglfagynketrkydkskwg
    ferdengnpkrdetlkhprcvfqimkkhyerydldkisaicgtpkelilkvydaycatgk
    pdkagtimyamgwtqhtvgvqniramsinqlllgnigvagggvnalrgeanvqgstdhgl
    lmhiypgylgtarasiptyeeytkkftpvskdpqsanwwsnfpkysasyiksmwpdadln
    eaygylpkgedgkdyswltlfddmfqgkikgffawgqnpacsgansnktrealtkldwmv
    nvnifdnetgsfwrgpdmdpkkiktevfflpcavaiekegsisnsgrwmqwryvgpeprk
    naipdgdlivelakrvqkllaktpgklaapvtklktdywvndhghfdphkiaklingfal
    kdfkvgdveykagqqiatfghlqadgsttsgcwiytgsytekgnmaarrdktqtdmqaki
    glypgwtwawpvnrriiynrasvdlngkpyapekavvewnaaekkwvgdvpdgpwppqad
    kekgkrafimkpegyaylygpgredgplpeyyepmecpviehpfsktlhnptalhfatee
    kavcdprypficstyrvtehwqtglmtrntpwlleaepqmfcemseelatlrgikngdkv
    ilesvrgklwakaiitkrikpfaiqgqqvhmvgipwhygwsfpknggdaaniltpsvgnp
    ntgipetkafmvnvtka
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0hL (L:)
    skgffvdttrctacrgcqvackqwhgnpatptentgfhqnppdfnfhtyklvrmheqeid
    gridwlffpdqcrhciappckatadmedesaiihddatgcvlftpktkdledyesvisac
    pydvprkvaesnqmakcdmcidritnglrpacvtscptgamnfgdlsemeamasarlaei
    kaaysdaklcdpddvrvifltahnpklyheyava