PDB entry 1h0e

View 1h0e on RCSB PDB site
Description: structure of t80a hang mutant
Class: hydrolase
Keywords: angiogenin, ribonuclease, hydrolase, nuclease, endonuclease, angiogenesis, protein synthesis inhibitor
Deposited on 2002-06-19, released 2003-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2004-02-06, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.211
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950 (Start-122)
      • engineered mutation (79)
    Domains in SCOPe 2.06: d1h0ea_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h0eA (A:)
    ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvtacklhggspwppcqyratagfrnvvvacenglpvhldqsif
    rrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h0eA (A:)
    dnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkn
    gnphrenlriskssfqvtacklhggspwppcqyratagfrnvvvacenglpvhldqsifr
    rp