PDB entry 1h0d

View 1h0d on RCSB PDB site
Description: crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f
Class: complex (antibody/hydrolase)
Keywords: ribonuclease, antibody
Deposited on 2002-06-19, released 2003-06-19
The last revision prior to the SCOP 1.75 freeze date was dated 2003-07-10, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment, light chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1h0da1, d1h0da2
  • Chain 'B':
    Compound: antibody fab fragment, heavy chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1h0db1, d1h0db2
  • Chain 'C':
    Compound: angiogenin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1h0dc_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0dA (A:)
    divltqspaslavslgqratiscrasesvdnygisfmswfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpltfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathaaspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0dB (B:)
    evmlvesggglvkpggslklscaasgftfssytmswvrqtpekrlewvatissgggntyy
    pdsvkgrftisrdiakntlylqmsslrsedtalyyctrlgdygyaytmdywgqgtsvtvs
    sakttppsvyplapgggggggamvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsspwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0dC (C:)
    ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
    rrp