PDB entry 1h0b

View 1h0b on RCSB PDB site
Description: endoglucanase cel12a from rhodothermus marinus
Class: hydrolase
Keywords: cellulase, endoglucanase, hydrolase
Deposited on 2002-06-17, released 2003-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: Rhodothermus marinus [TaxId:29549]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H0B (225-End)
      • conflict (68-89)
      • conflict (91-92)
      • conflict (216)
    • Uniprot O33897 (91-224)
    Domains in SCOPe 2.07: d1h0ba_
  • Chain 'B':
    Compound: cellulase
    Species: Rhodothermus marinus [TaxId:29549]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H0B (225-End)
      • conflict (68-89)
      • conflict (91-92)
      • conflict (216)
    • Uniprot O33897 (91-224)
    Domains in SCOPe 2.07: d1h0bb_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h0bA (A:)
    mtvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaayp
    aiyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngys
    ggaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldl
    kafiddavargyirpewylhavetgfelweggaglrsadfsvtvqklaaaleikrasqpe
    lapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h0bA (A:)
    tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
    iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
    gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
    afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h0bB (B:)
    mtvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaayp
    aiyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngys
    ggaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldl
    kafiddavargyirpewylhavetgfelweggaglrsadfsvtvqklaaaleikrasqpe
    lapedpedvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h0bB (B:)
    tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
    iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
    gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
    afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkla