PDB entry 1h0a

View 1h0a on RCSB PDB site
Description: epsin enth bound to ins(1,4,5)p3
Class: endocytosis
Keywords: endocytosis, epsin, enth, clathrin, triskelion, coated vesicles, alpha-alpha superhelix, ins(1, 4, 5)p3
Deposited on 2002-06-12, released 2002-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epsin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h0aa_
  • Heterogens: DIO, I3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0aA (A:)
    mstsslrrqmknivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmi
    wkrlndhgknwrhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqg
    vnvrekakqlvallrdedrlreerahalktkeklaqta