PDB entry 1h0a

View 1h0a on RCSB PDB site
Description: epsin enth bound to ins(1,4,5)p3
Class: endocytosis
Keywords: endocytosis, epsin, enth, clathrin, triskelion, coated vesicles, alpha-alpha superhelix, ins(1, 4, 5)p3
Deposited on 2002-06-12, released 2002-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: epsin
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O88339 (0-157)
  Domains in SCOPe 2.08: d1h0aa_
• Heterogens: DIO, I3P, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h0aA (A:)
  mstsslrrqmknivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmi
  wkrlndhgknwrhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqg
  vnvrekakqlvallrdedrlreerahalktkeklaqta