PDB entry 1h02

View 1h02 on RCSB PDB site
Description: human insulin-like growth factor; srs daresbury data
Class: cell adhesion
Keywords: cell adhesion, growth factor, insulin family, igf-1, plasma
Deposited on 2002-06-11, released 2002-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.26
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: insulin-like growth factor I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h02b_
  • Heterogens: C15, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1h02B (B:)
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkpaksa

    Sequence, based on observed residues (ATOM records): (download) 
    >1h02B (B:)
etlcgaelvdalqfvcgdrgfyfnkptgygsssapqtgivdeccfrscdlrrlemycapl
kpak