PDB entry 1gzw

View 1gzw on RCSB PDB site
Description: x-ray crystal structure of human galectin-1
Class: lectin
Keywords: carbohydrate-binding proteins, galactosides, galectin, carbohydrate-binding site, x-ray structure
Deposited on 2002-06-07, released 2004-01-08
The last revision prior to the SCOP 1.73 freeze date was dated 2004-01-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.216
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gzwa_
  • Chain 'B':
    Compound: galectin-1
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1gzwb_
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gzwA (A:)
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gzwB (B:)
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd