PDB entry 1gzu

View 1gzu on RCSB PDB site
Description: crystal structure of human nicotinamide mononucleotide adenylyltransferase in complex with nmn
Class: transferase
Keywords: transferase, nad biosynthesis, adenylyltransferase
Deposited on 2002-06-06, released 2002-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.248
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gzua_
  • Chain 'B':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gzub_
  • Chain 'C':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gzuc_
  • Heterogens: NMN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gzuA (A:)
    mrgshhhhhhgsensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiis
    pvgdaykkkglipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleas
    dcdhqqnsptlerpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlw
    kseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirra
    lrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzuA (A:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadllesf
    avpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandiss
    tkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gzuB (B:)
    mrgshhhhhhgsensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiis
    pvgdaykkkglipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleas
    dcdhqqnsptlerpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlw
    kseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirra
    lrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzuB (B:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadllesf
    avpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandiss
    tkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gzuC (C:)
    mrgshhhhhhgsensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiis
    pvgdaykkkglipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleas
    dcdhqqnsptlerpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlw
    kseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirra
    lrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzuC (C:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadllesf
    avpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandiss
    tkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplq