PDB entry 1gzt

View 1gzt on RCSB PDB site
Description: pseudomonas aeruginosa lectin ii (pa-iil) together with fucose
Deposited on 2002-06-06, released 2002-11-19
The last revision prior to the SCOP 1.69 freeze date was dated 2002-11-19, with a file datestamp of 2002-11-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.13708
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1gzta_
  • Chain 'B':
    Domains in SCOP 1.69: d1gztb_
  • Chain 'C':
    Domains in SCOP 1.69: d1gztc_
  • Chain 'D':
    Domains in SCOP 1.69: d1gztd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gztA (A:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gztA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gztB (B:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gztB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gztC (C:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gztC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gztD (D:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gztD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg