PDB entry 1gzs

View 1gzs on RCSB PDB site
Description: crystal structure of the complex between the gef domain of the salmonella typhimurium sope toxin and human cdc42
Class: complex (toxin/cell cycle protein)
Keywords: sope, cdc42, salmonella typhimurium, gef, toxin, GTP-binding, lipoprotein, prenylation
Deposited on 2002-06-05, released 2002-09-12
The last revision prior to the SCOP 1.75 freeze date was dated 2002-09-12, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gzsa_
  • Chain 'B':
    Compound: sope
    Species: SALMONELLA TYPHIMURIUM
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gzsb_
  • Chain 'C':
    Compound: GTP-binding protein
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gzsc_
  • Chain 'D':
    Compound: sope
    Species: SALMONELLA TYPHIMURIUM
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gzsd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gzsA (A:)
    gsmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
    agqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
    lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzsA (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzsB (B:)
    gsltnkvvkdfmlqtlndidirgsaskdpayasqtreailsavysknkdqccnlliskgi
    niapflqeigeaaknaglpgttkndvftpsgaganpfitplissanskyprmfinqhqqa
    sfkiyaekiimtevaplfnecamptpqqfqlileniankyiqntp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gzsC (C:)
    gsmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
    agqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
    lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzsC (C:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gzsD (D:)
    gsltnkvvkdfmlqtlndidirgsaskdpayasqtreailsavysknkdqccnlliskgi
    niapflqeigeaaknaglpgttkndvftpsgaganpfitplissanskyprmfinqhqqa
    sfkiyaekiimtevaplfnecamptpqqfqlileniankyiqntp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzsD (D:)
    sltnkvvkdfmlqtlndidirgsaskdpayasqtreailsavysknkdqccnlliskgin
    iapflqeigeaaknaglpgttkndvftpsgaganpfitplissanskyprmfinqhqqas
    fkiyaekiimtevaplfnecamptpqqfqlileniankyiqntp