PDB entry 1gzs

View 1gzs on RCSB PDB site
Description:
Deposited on 2002-06-05, released 2002-09-12
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-16, with a file datestamp of 2003-01-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gzsa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gzsb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gzsc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gzsd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzsA (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzsB (B:)
    gsltnkvvkdfmlqtlndidirgsaskdpayasqtreailsavysknkdqccnlliskgi
    niapflqeigeaaknaglpgttkndvftpsgaganpfitplissanskyprmfinqhqqa
    sfkiyaekiimtevaplfnecamptpqqfqlileniankyiqntp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzsC (C:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzsD (D:)
    sltnkvvkdfmlqtlndidirgsaskdpayasqtreailsavysknkdqccnlliskgin
    iapflqeigeaaknaglpgttkndvftpsgaganpfitplissanskyprmfinqhqqas
    fkiyaekiimtevaplfnecamptpqqfqlileniankyiqntp